Lineage for d1zagc1 (1zag C:184-278)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749841Protein Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain [48965] (1 species)
    fat depleting factor related to class I MHC
  7. 2749842Species Human (Homo sapiens) [TaxId:9606] [48966] (8 PDB entries)
    Uniprot P25311 22-294
  8. 2749849Domain d1zagc1: 1zag C:184-278 [20853]
    Other proteins in same PDB: d1zaga2, d1zagb2, d1zagc2, d1zagd2
    complexed with nag

Details for d1zagc1

PDB Entry: 1zag (more details), 2.8 Å

PDB Description: human zinc-alpha-2-glycoprotein
PDB Compounds: (C:) protein (zinc-alpha-2-glycoprotein)

SCOPe Domain Sequences for d1zagc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zagc1 b.1.1.2 (C:184-278) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvavppqdtapyschvqhsslaqplvvpweas

SCOPe Domain Coordinates for d1zagc1:

Click to download the PDB-style file with coordinates for d1zagc1.
(The format of our PDB-style files is described here.)

Timeline for d1zagc1: