Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain [48965] (1 species) fat depleting factor related to class I MHC |
Species Human (Homo sapiens) [TaxId:9606] [48966] (7 PDB entries) |
Domain d1zagb1: 1zag B:184-278 [20852] Other proteins in same PDB: d1zaga2, d1zagb2, d1zagc2, d1zagd2 |
PDB Entry: 1zag (more details), 2.8 Å
SCOP Domain Sequences for d1zagb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zagb1 b.1.1.2 (B:184-278) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens)} qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq swvvvavppqdtapyschvqhsslaqplvvpweas
Timeline for d1zagb1: