Lineage for d1zaga2 (1zag A:5-183)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600721Protein Zinc-alpha-2-glycoprotein, ZAG [54487] (1 species)
    fat depleting factor related to class I MHC
  7. 600722Species Human (Homo sapiens) [TaxId:9606] [54488] (7 PDB entries)
  8. 600727Domain d1zaga2: 1zag A:5-183 [38315]
    Other proteins in same PDB: d1zaga1, d1zagb1, d1zagc1, d1zagd1

Details for d1zaga2

PDB Entry: 1zag (more details), 2.8 Å

PDB Description: human zinc-alpha-2-glycoprotein

SCOP Domain Sequences for d1zaga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zaga2 d.19.1.1 (A:5-183) Zinc-alpha-2-glycoprotein, ZAG {Human (Homo sapiens)}
dgrysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwk
qdsqlqkaredifmetlkdiveyyndsngshvlqgrfgceiennrssgafwkyyydgkdy
iefnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildr

SCOP Domain Coordinates for d1zaga2:

Click to download the PDB-style file with coordinates for d1zaga2.
(The format of our PDB-style files is described here.)

Timeline for d1zaga2: