![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
![]() | Protein automated matches [190826] (23 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [225380] (3 PDB entries) |
![]() | Domain d3b4ta1: 3b4t A:1-151 [208521] Other proteins in same PDB: d3b4ta2, d3b4tb2, d3b4tc2, d3b4td2, d3b4te2, d3b4tf2 automated match to d1r6la1 complexed with po4 |
PDB Entry: 3b4t (more details), 2.1 Å
SCOPe Domain Sequences for d3b4ta1:
Sequence, based on SEQRES records: (download)
>d3b4ta1 d.14.1.0 (A:1-151) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} skredgrldhelrpviitrgftenpagsvliefghtkvlctasvtegvprwrkatglgwl taeyamlpsathsrsdresvrgrlsgrtqeisrligrslracidlaalgentiaidcdvl qadggtrtaaitgayvaladavtylsaagkl
>d3b4ta1 d.14.1.0 (A:1-151) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} skredgrldhelrpviitrgftenpagsvliefghtkvlctasvtegvpatglgwltaey amlpsathsrsdresvrgrlsgrtqeisrligrslracidlaalgentiaidcdvlqadg gtrtaaitgayvaladavtylsaagkl
Timeline for d3b4ta1: