SCOPe 2.08: Domain d3b4tc2: 3b4t C:152-247

Lineage for d3b4tc2 (3b4t C:152-247)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134

4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families)

5. Family d.101.1.0: automated matches [227218] (1 protein)
   not a true family

6. Protein automated matches [226956] (5 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [225381] (1 PDB entry)

8. Domain d3b4tc2: 3b4t C:152-247 [208526]
   Other proteins in same PDB: d3b4ta1, d3b4tb1, d3b4tc1, d3b4td1, d3b4te1, d3b4tf1
   automated match to d1r6la2
   complexed with po4

Details for d3b4tc2

PDB Entry: 3b4t, 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis rnase ph, the mycobacterium tuberculosis structural genomics consortium target rv1340

PDB Compounds: (C:) Ribonuclease PH

SCOPe Domain Sequences for d3b4tc2:

Sequence; same for both SEQRES and ATOM records:

>d3b4tc2 d.101.1.0 (C:152-247) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sdprplscaiaavsvgvvdgrirvdlpyeedsraevdmnvvatdtgtlveiqgtgegatf
arstldklldmalgacdtlfaaqrdalalpypgvlp

Timeline for d3b4tc2:

• d3b4tc2 first appeared in SCOPe 2.03
  
• d3b4tc2 appears in SCOPe 2.07