Lineage for d3b4te1 (3b4t E:1-151)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2931115Species Mycobacterium tuberculosis [TaxId:83332] [225380] (3 PDB entries)
  8. 2931122Domain d3b4te1: 3b4t E:1-151 [208529]
    Other proteins in same PDB: d3b4ta2, d3b4tb2, d3b4tc2, d3b4td2, d3b4te2, d3b4tf2
    automated match to d1r6la1
    complexed with po4

Details for d3b4te1

PDB Entry: 3b4t (more details), 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis rnase ph, the mycobacterium tuberculosis structural genomics consortium target rv1340
PDB Compounds: (E:) Ribonuclease PH

SCOPe Domain Sequences for d3b4te1:

Sequence, based on SEQRES records: (download)

>d3b4te1 d.14.1.0 (E:1-151) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
skredgrldhelrpviitrgftenpagsvliefghtkvlctasvtegvprwrkatglgwl
taeyamlpsathsrsdresvrgrlsgrtqeisrligrslracidlaalgentiaidcdvl
qadggtrtaaitgayvaladavtylsaagkl

Sequence, based on observed residues (ATOM records): (download)

>d3b4te1 d.14.1.0 (E:1-151) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
skredgrldhelrpviitrgftenpagsvliefghtkvlctasvtegvplgwltaeyaml
psathsrsdresvrgrlsgrtqeisrligrslracidlaalgentiaidcdvlqadggtr
taaitgayvaladavtylsaagkl

SCOPe Domain Coordinates for d3b4te1:

Click to download the PDB-style file with coordinates for d3b4te1.
(The format of our PDB-style files is described here.)

Timeline for d3b4te1: