Lineage for d3a4ia1 (3a4i A:1-189)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590910Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1591169Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 1591170Protein automated matches [190116] (16 species)
    not a true protein
  7. 1591224Species Pyrococcus horikoshii [TaxId:53953] [225700] (1 PDB entry)
  8. 1591225Domain d3a4ia1: 3a4i A:1-189 [208101]
    Other proteins in same PDB: d3a4ia2, d3a4ib2
    automated match to d1gpma1

Details for d3a4ia1

PDB Entry: 3a4i (more details), 1.79 Å

PDB Description: Crystal structure of GMP synthetase PH1347 from Pyrococcus horikoshii OT3
PDB Compounds: (A:) GMP synthase [glutamine-hydrolyzing] subunit B

SCOPe Domain Sequences for d3a4ia1:

Sequence, based on SEQRES records: (download)

>d3a4ia1 c.26.2.0 (A:1-189) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mdwgrfveekvreiretvgdskaiialsggvdsstaavlahkaigdrlhavfvntgflrk
gepefvvktfrdefgmnlhyvdaqdrffsalkgvtdpeekrkiigrvfievfeevakkig
aeyliqgtiapdwiesqgkikshhnvgglpeklnlklieplrdlykdevrelakflglpe
kiynrmpfp

Sequence, based on observed residues (ATOM records): (download)

>d3a4ia1 c.26.2.0 (A:1-189) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mdwgrfveekvreiretvgdskaiialsggvdsstaavlahkaigdrlhavfvntgflrk
gepefvvktfrdefgmnlhyvdaqdrffsalkgvtdpeekrkiigrvfievfeevakkig
aeyliqgtiapnlklieplrdlykdevrelakflglpekiynrmpfp

SCOPe Domain Coordinates for d3a4ia1:

Click to download the PDB-style file with coordinates for d3a4ia1.
(The format of our PDB-style files is described here.)

Timeline for d3a4ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3a4ia2