Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
Protein automated matches [190116] (13 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:53953] [225700] (1 PDB entry) |
Domain d3a4ia1: 3a4i A:1-189 [208101] Other proteins in same PDB: d3a4ia2, d3a4ib2 automated match to d1gpma1 |
PDB Entry: 3a4i (more details), 1.79 Å
SCOPe Domain Sequences for d3a4ia1:
Sequence, based on SEQRES records: (download)
>d3a4ia1 c.26.2.0 (A:1-189) automated matches {Pyrococcus horikoshii [TaxId: 53953]} mdwgrfveekvreiretvgdskaiialsggvdsstaavlahkaigdrlhavfvntgflrk gepefvvktfrdefgmnlhyvdaqdrffsalkgvtdpeekrkiigrvfievfeevakkig aeyliqgtiapdwiesqgkikshhnvgglpeklnlklieplrdlykdevrelakflglpe kiynrmpfp
>d3a4ia1 c.26.2.0 (A:1-189) automated matches {Pyrococcus horikoshii [TaxId: 53953]} mdwgrfveekvreiretvgdskaiialsggvdsstaavlahkaigdrlhavfvntgflrk gepefvvktfrdefgmnlhyvdaqdrffsalkgvtdpeekrkiigrvfievfeevakkig aeyliqgtiapnlklieplrdlykdevrelakflglpekiynrmpfp
Timeline for d3a4ia1: