SCOPe 2.04: Domain d3a4ib1: 3a4i B:1-189

Lineage for d3a4ib1 (3a4i B:1-189)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (16 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [225700] (1 PDB entry)

8. Domain d3a4ib1: 3a4i B:1-189 [208103]
   Other proteins in same PDB: d3a4ia2, d3a4ib2
   automated match to d1gpma1

Details for d3a4ib1

PDB Entry: 3a4i, 1.79 Å

PDB Description: Crystal structure of GMP synthetase PH1347 from Pyrococcus horikoshii OT3

PDB Compounds: (B:) GMP synthase [glutamine-hydrolyzing] subunit B

SCOPe Domain Sequences for d3a4ib1:

Sequence, based on SEQRES records:

>d3a4ib1 c.26.2.0 (B:1-189) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mdwgrfveekvreiretvgdskaiialsggvdsstaavlahkaigdrlhavfvntgflrk
gepefvvktfrdefgmnlhyvdaqdrffsalkgvtdpeekrkiigrvfievfeevakkig
aeyliqgtiapdwiesqgkikshhnvgglpeklnlklieplrdlykdevrelakflglpe
kiynrmpfp

Sequence, based on observed residues (ATOM records):

>d3a4ib1 c.26.2.0 (B:1-189) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mdwgrfveekvreiretvgdskaiialsggvdsstaavlahkaigdrlhavfvntgflrk
gepefvvktfrdefgmnlhyvdaqdrffsalkgvtdpeekrkiigrvfievfeevakkig
aeyliqgtiapnlklieplrdlykdevrelakflglpekiynrmpfp

Timeline for d3a4ib1:

• d3a4ib1 first appeared in SCOPe 2.03
  
• d3a4ib1 appears in SCOPe 2.05
  
• d3a4ib1 appears in the current release, SCOPe 2.08