SCOPe 2.08: Domain d2znzb2: 2znz B:85-170

Lineage for d2znzb2 (2znz B:85-170)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins)
   octamer: tetramer of dimers
   automatically mapped to Pfam PF01037

6. Protein Putative transcriptional regulator PH1519 [102968] (1 species)
   archaeal feast/famine regulatory protein

7. Species Pyrococcus horikoshii [TaxId:53953] [102969] (4 PDB entries)
   identical sequence to Pyrococcus sp. ot3 protein

8. Domain d2znzb2: 2znz B:85-170 [207919]
   Other proteins in same PDB: d2znza1, d2znzb1, d2znzc1, d2znzd1, d2znze1, d2znzf1, d2znzg1, d2znzh1
   automated match to d1ri7a2
   complexed with lys

Details for d2znzb2

PDB Entry: 2znz, 2.39 Å

PDB Description: Crystal structure of FFRP

PDB Compounds: (B:) Uncharacterized HTH-type transcriptional regulator PH1519

SCOPe Domain Sequences for d2znzb2:

Sequence; same for both SEQRES and ATOM records:

>d2znzb2 d.58.4.2 (B:85-170) Putative transcriptional regulator PH1519 {Pyrococcus horikoshii [TaxId: 53953]}
ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli
gsipgvegthtmivlkthkettelpi

Timeline for d2znzb2:

• d2znzb2 first appeared in SCOPe 2.03
  
• d2znzb2 appears in SCOPe 2.07