Lineage for d2znzf2 (2znz F:85-170)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949722Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins)
    octamer: tetramer of dimers
    automatically mapped to Pfam PF01037
  6. 2949727Protein Putative transcriptional regulator PH1519 [102968] (1 species)
    archaeal feast/famine regulatory protein
  7. 2949728Species Pyrococcus horikoshii [TaxId:53953] [102969] (4 PDB entries)
    identical sequence to Pyrococcus sp. ot3 protein
  8. 2949734Domain d2znzf2: 2znz F:85-170 [207927]
    Other proteins in same PDB: d2znza1, d2znzb1, d2znzc1, d2znzd1, d2znze1, d2znzf1, d2znzg1, d2znzh1
    automated match to d1ri7a2
    complexed with lys

Details for d2znzf2

PDB Entry: 2znz (more details), 2.39 Å

PDB Description: Crystal structure of FFRP
PDB Compounds: (F:) Uncharacterized HTH-type transcriptional regulator PH1519

SCOPe Domain Sequences for d2znzf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2znzf2 d.58.4.2 (F:85-170) Putative transcriptional regulator PH1519 {Pyrococcus horikoshii [TaxId: 53953]}
ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli
gsipgvegthtmivlkthkettelpi

SCOPe Domain Coordinates for d2znzf2:

Click to download the PDB-style file with coordinates for d2znzf2.
(The format of our PDB-style files is described here.)

Timeline for d2znzf2: