| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
| Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins) octamer: tetramer of dimers automatically mapped to Pfam PF01037 |
| Protein Putative transcriptional regulator PH1519 [102968] (1 species) archaeal feast/famine regulatory protein |
| Species Pyrococcus horikoshii [TaxId:53953] [102969] (4 PDB entries) identical sequence to Pyrococcus sp. ot3 protein |
| Domain d2znzf2: 2znz F:85-170 [207927] Other proteins in same PDB: d2znza1, d2znzb1, d2znzc1, d2znzd1, d2znze1, d2znzf1, d2znzg1, d2znzh1 automated match to d1ri7a2 complexed with lys |
PDB Entry: 2znz (more details), 2.39 Å
SCOPe Domain Sequences for d2znzf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2znzf2 d.58.4.2 (F:85-170) Putative transcriptional regulator PH1519 {Pyrococcus horikoshii [TaxId: 53953]}
ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli
gsipgvegthtmivlkthkettelpi
Timeline for d2znzf2: