SCOP 1.55: Domain d1a1ma1: 1a1m A:182-278

Lineage for d1a1ma1 (1a1m A:182-278)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)

7. Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [48952] (2 PDB entries)

8. Domain d1a1ma1: 1a1m A:182-278 [20753]
   Other proteins in same PDB: d1a1ma2

Details for d1a1ma1

PDB Entry: 1a1m, 2.3 Å

PDB Description: mhc class i molecule b*5301 complexed with peptide tpydinqml from gag protein of hiv2

SCOP Domain Sequences for d1a1ma1:

Sequence; same for both SEQRES and ATOM records:

>d1a1ma1 b.1.1.2 (A:182-278) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-B53}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwephh

Timeline for d1a1ma1:

• d1a1ma1 appears in SCOP 1.57
  
• d1a1ma1 appears in the current release, SCOPe 2.08