| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (181 species) not a true protein |
| Species Thermus thermophilus HB8 [TaxId:300852] [187989] (16 PDB entries) |
| Domain d2xxbb1: 2xxb B:22-164 [207398] Other proteins in same PDB: d2xxba2, d2xxbb2 automated match to d1llda1 complexed with amp; mutant |
PDB Entry: 2xxb (more details), 2.15 Å
SCOPe Domain Sequences for d2xxbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xxbb1 c.2.1.0 (B:22-164) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvwag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayalsglppgrvvgsg
Timeline for d2xxbb1: