Lineage for d2xxba2 (2xxb A:165-331)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680841Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1680842Protein automated matches [226850] (24 species)
    not a true protein
  7. 1680966Species Thermus thermophilus HB8 [TaxId:300852] [225328] (7 PDB entries)
  8. 1680979Domain d2xxba2: 2xxb A:165-331 [207397]
    Other proteins in same PDB: d2xxba1, d2xxbb1
    automated match to d1llda2
    complexed with amp; mutant

Details for d2xxba2

PDB Entry: 2xxb (more details), 2.15 Å

PDB Description: penta-mutant of thermus thermophilus lactate dehydrogenase, complex with amp
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2xxba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xxba2 d.162.1.0 (A:165-331) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
tildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargral
spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpevag
vlevslslprilgaggvagtvypslspeeraalrrsaeilkeaafalgf

SCOPe Domain Coordinates for d2xxba2:

Click to download the PDB-style file with coordinates for d2xxba2.
(The format of our PDB-style files is described here.)

Timeline for d2xxba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xxba1