Lineage for d2xxba1 (2xxb A:22-164)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1581655Species Thermus thermophilus HB8 [TaxId:300852] [187989] (16 PDB entries)
  8. 1581679Domain d2xxba1: 2xxb A:22-164 [207396]
    Other proteins in same PDB: d2xxba2, d2xxbb2
    automated match to d1llda1
    complexed with amp; mutant

Details for d2xxba1

PDB Entry: 2xxb (more details), 2.15 Å

PDB Description: penta-mutant of thermus thermophilus lactate dehydrogenase, complex with amp
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2xxba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xxba1 c.2.1.0 (A:22-164) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvwag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayalsglppgrvvgsg

SCOPe Domain Coordinates for d2xxba1:

Click to download the PDB-style file with coordinates for d2xxba1.
(The format of our PDB-style files is described here.)

Timeline for d2xxba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xxba2