SCOPe 2.04: Domain d2x3ua2: 2x3u A:140-303

Lineage for d2x3ua2 (2x3u A:140-303)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (15 species)
   not a true protein

7. Species Anabaena sp. [TaxId:1168] [226793] (1 PDB entry)

8. Domain d2x3ua2: 2x3u A:140-303 [207122]
   Other proteins in same PDB: d2x3ua1
   automated match to d1frna2
   complexed with fad, gol, so4; mutant

Details for d2x3ua2

PDB Entry: 2x3u, 1.93 Å

PDB Description: Ferredoxin-NADP reductase mutant with Tyr 303 replaced by Phe (Y303F)

PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d2x3ua2:

Sequence; same for both SEQRES and ATOM records:

>d2x3ua2 c.25.1.0 (A:140-303) automated matches {Anabaena sp. [TaxId: 1168]}
mllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpni
lykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadelwqliknqkthty
icglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvetf

Timeline for d2x3ua2:

• d2x3ua2 first appeared in SCOPe 2.03
  
• d2x3ua2 appears in SCOPe 2.05
  
• d2x3ua2 appears in the current release, SCOPe 2.08