Lineage for d2x3ua2 (2x3u A:140-303)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859901Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2859902Protein automated matches [226871] (19 species)
    not a true protein
  7. 2859903Species Anabaena sp. [TaxId:1168] [226793] (1 PDB entry)
  8. 2859904Domain d2x3ua2: 2x3u A:140-303 [207122]
    Other proteins in same PDB: d2x3ua1
    automated match to d1frna2
    complexed with fad, gol, so4; mutant

Details for d2x3ua2

PDB Entry: 2x3u (more details), 1.93 Å

PDB Description: Ferredoxin-NADP reductase mutant with Tyr 303 replaced by Phe (Y303F)
PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d2x3ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x3ua2 c.25.1.0 (A:140-303) automated matches {Anabaena sp. [TaxId: 1168]}
mllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpni
lykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadelwqliknqkthty
icglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvetf

SCOPe Domain Coordinates for d2x3ua2:

Click to download the PDB-style file with coordinates for d2x3ua2.
(The format of our PDB-style files is described here.)

Timeline for d2x3ua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2x3ua1