| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
| Family c.25.1.0: automated matches [227163] (1 protein) not a true family |
| Protein automated matches [226871] (19 species) not a true protein |
| Species Anabaena sp. [TaxId:1168] [226793] (1 PDB entry) |
| Domain d2x3ua2: 2x3u A:140-303 [207122] Other proteins in same PDB: d2x3ua1 automated match to d1frna2 complexed with fad, gol, so4; mutant |
PDB Entry: 2x3u (more details), 1.93 Å
SCOPe Domain Sequences for d2x3ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x3ua2 c.25.1.0 (A:140-303) automated matches {Anabaena sp. [TaxId: 1168]}
mllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpni
lykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadelwqliknqkthty
icglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvetf
Timeline for d2x3ua2: