SCOPe 2.08: Domain d2wjuf2: 2wju F:81-222

Lineage for d2wjuf2 (2wju F:81-222)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)

8. Domain d2wjuf2: 2wju F:81-222 [206868]
   Other proteins in same PDB: d2wjua1, d2wjub1, d2wjuc1, d2wjud1, d2wjue1, d2wjuf1, d2wjug1, d2wjuh1
   automated match to d1agsa1
   complexed with gsh

Details for d2wjuf2

PDB Entry: 2wju, 2.3 Å

PDB Description: glutathione transferase a2-2 in complex with glutathione

PDB Compounds: (F:) glutathione-s-transferase a2-2

SCOPe Domain Sequences for d2wjuf2:

Sequence; same for both SEQRES and ATOM records:

>d2wjuf2 a.45.1.1 (F:81-222) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lygkdikekalidmyiegiadlgemilllpftqpeeqdaklaliqektknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleesrkifrf

Timeline for d2wjuf2:

• d2wjuf2 first appeared in SCOPe 2.03
  
• d2wjuf2 appears in SCOPe 2.07