| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein automated matches [226848] (14 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries) |
| Domain d2wjuf2: 2wju F:81-222 [206868] Other proteins in same PDB: d2wjua1, d2wjub1, d2wjuc1, d2wjud1, d2wjue1, d2wjuf1, d2wjug1, d2wjuh1 automated match to d1agsa1 complexed with gsh |
PDB Entry: 2wju (more details), 2.3 Å
SCOPe Domain Sequences for d2wjuf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wjuf2 a.45.1.1 (F:81-222) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lygkdikekalidmyiegiadlgemilllpftqpeeqdaklaliqektknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleesrkifrf
Timeline for d2wjuf2: