PDB entry 2wju

View 2wju on RCSB PDB site
Description: Glutathione transferase A2-2 in complex with glutathione
Class: transferase
Keywords: transferase, glutathione
Deposited on 2009-05-29, released 2009-06-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.24811
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione-s-transferase a2-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • see remark 999 (111)
    Domains in SCOPe 2.06: d2wjua1, d2wjua2
  • Chain 'B':
    Compound: glutathione-s-transferase a2-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • see remark 999 (111)
    Domains in SCOPe 2.06: d2wjub1, d2wjub2
  • Chain 'C':
    Compound: glutathione-s-transferase a2-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • see remark 999 (111)
    Domains in SCOPe 2.06: d2wjuc1, d2wjuc2
  • Chain 'D':
    Compound: glutathione-s-transferase a2-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • see remark 999 (111)
    Domains in SCOPe 2.06: d2wjud1, d2wjud2
  • Chain 'E':
    Compound: glutathione-s-transferase a2-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • see remark 999 (111)
    Domains in SCOPe 2.06: d2wjue1, d2wjue2
  • Chain 'F':
    Compound: glutathione-s-transferase a2-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • see remark 999 (111)
    Domains in SCOPe 2.06: d2wjuf1, d2wjuf2
  • Chain 'G':
    Compound: glutathione-s-transferase a2-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • see remark 999 (111)
    Domains in SCOPe 2.06: d2wjug1, d2wjug2
  • Chain 'H':
    Compound: glutathione-s-transferase a2-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • see remark 999 (111)
    Domains in SCOPe 2.06: d2wjuh1, d2wjuh2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wjuA (A:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wjuA (A:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wjuB (B:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wjuB (B:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wjuC (C:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wjuC (C:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wjuD (D:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wjuD (D:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2wjuE (E:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wjuE (E:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2wjuF (F:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wjuF (F:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2wjuG (G:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wjuG (G:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2wjuH (H:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wjuH (H:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf