SCOPe 2.08: Domain d2vr0a_: 2vr0 A:

Lineage for d2vr0a_ (2vr0 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein automated matches [190276] (12 species)
   not a true protein

7. Species Desulfovibrio vulgaris [TaxId:882] [187896] (2 PDB entries)

8. Domain d2vr0a_: 2vr0 A: [206418]
   automated match to d2j7ah_
   complexed with ca, hec, hqo

Details for d2vr0a_

PDB Entry: 2vr0, 2.8 Å

PDB Description: crystal structure of cytochrome c nitrite reductase nrfha complex bound to the hqno inhibitor

PDB Compounds: (A:) cytochrome c nitrite reductase, catalytic subunit nfra

SCOPe Domain Sequences for d2vr0a_:

Sequence; same for both SEQRES and ATOM records:

>d2vr0a_ a.138.1.3 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
gcsdvstelktpvyktkltaeeirnsafkpefpkqyasyerndettvmteykgsvpfnkn
dnvnplpegyrhaqpylknlwlgypfmyeyrearghtyaiqdflhidrinryaekgglpa
tcwncktpkmmewvkesgdgfwakdvnefrdkidmkdhtigcatchdpqtmelritsvpl
tdylvsqgkdpkklprnemralvcgqchveyyfngptmgvnkkpvfpwaegfdpadmyry
ydkhgdlqvkgfegkfadwthpasktpmikaqhpeyetwingthgaagvtcadchmsytr
sddkkkisshwwtspmkdpemracrqchsdktpdylksrvlftqkrtfdlllaaqevsvk
aheavrlaneyqgakaagyddlmiqaremvrkgqffwdyvsaensvgfhnpakaldtlaq
sqqfsqkaidlameatqygigkdlsgdiktivppilkmnrklqqdpefmkthkwfqylpv
lpkadqvwdgqkrlv

Timeline for d2vr0a_:

• d2vr0a_ first appeared in SCOPe 2.03
  
• d2vr0a_ appears in SCOPe 2.07