SCOPe 2.05: Domain d2v82a_: 2v82 A:

Lineage for d2v82a_ (2v82 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (63 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [225333] (3 PDB entries)

8. Domain d2v82a_: 2v82 A: [206270]
   automated match to d1vlwc_
   complexed with kdp

Details for d2v82a_

PDB Entry: 2v82, 2.1 Å

PDB Description: kdpgal complexed to kdpgal

PDB Compounds: (A:) 2-dehydro-3-deoxy-6-phosphogalactonate aldolase

SCOPe Domain Sequences for d2v82a_:

Sequence; same for both SEQRES and ATOM records:

>d2v82a_ c.1.10.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
qwqtklpliailrgitpdealahvgavidagfdaveiplnspqweqsipaivdaygdkal
igagtvlkpeqvdalarmgcqlivtpnihsevirravgygmtvcpgcatateaftaleag
aqalkifpssafgpqyikalkavlpsdiavfavggvtpenlaqwidagcagaglgsdlyr
agqsvertaqqaaafvkayreavqlh

Timeline for d2v82a_:

• d2v82a_ first appeared in SCOPe 2.03
  
• d2v82a_ appears in SCOPe 2.04
  
• d2v82a_ is called d2v82a1 in SCOPe 2.06
  
• d2v82a_ appears in the current release, SCOPe 2.08, called d2v82a1