Lineage for d2v82a1 (2v82 A:2-205)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836283Species Escherichia coli [TaxId:562] [225333] (3 PDB entries)
  8. 2836288Domain d2v82a1: 2v82 A:2-205 [206270]
    Other proteins in same PDB: d2v82a2
    automated match to d1vlwc_
    complexed with kdp

Details for d2v82a1

PDB Entry: 2v82 (more details), 2.1 Å

PDB Description: kdpgal complexed to kdpgal
PDB Compounds: (A:) 2-dehydro-3-deoxy-6-phosphogalactonate aldolase

SCOPe Domain Sequences for d2v82a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v82a1 c.1.10.0 (A:2-205) automated matches {Escherichia coli [TaxId: 562]}
qwqtklpliailrgitpdealahvgavidagfdaveiplnspqweqsipaivdaygdkal
igagtvlkpeqvdalarmgcqlivtpnihsevirravgygmtvcpgcatateaftaleag
aqalkifpssafgpqyikalkavlpsdiavfavggvtpenlaqwidagcagaglgsdlyr
agqsvertaqqaaafvkayreavq

SCOPe Domain Coordinates for d2v82a1:

Click to download the PDB-style file with coordinates for d2v82a1.
(The format of our PDB-style files is described here.)

Timeline for d2v82a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v82a2