| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
| Protein automated matches [190115] (94 species) not a true protein |
| Species Escherichia coli [TaxId:562] [225333] (3 PDB entries) |
| Domain d2v82a1: 2v82 A:2-205 [206270] Other proteins in same PDB: d2v82a2 automated match to d1vlwc_ complexed with kdp |
PDB Entry: 2v82 (more details), 2.1 Å
SCOPe Domain Sequences for d2v82a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v82a1 c.1.10.0 (A:2-205) automated matches {Escherichia coli [TaxId: 562]}
qwqtklpliailrgitpdealahvgavidagfdaveiplnspqweqsipaivdaygdkal
igagtvlkpeqvdalarmgcqlivtpnihsevirravgygmtvcpgcatateaftaleag
aqalkifpssafgpqyikalkavlpsdiavfavggvtpenlaqwidagcagaglgsdlyr
agqsvertaqqaaafvkayreavq
Timeline for d2v82a1: