Lineage for d1vlwc_ (1vlw C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1821672Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1822059Protein KDPG aldolase [51584] (3 species)
  7. 1822082Species Thermotoga maritima [TaxId:2336] [110357] (1 PDB entry)
    Uniprot Q9WXS1
  8. 1822085Domain d1vlwc_: 1vlw C: [108870]
    Structural genomics target

Details for d1vlwc_

PDB Entry: 1vlw (more details), 2.3 Å

PDB Description: Crystal structure of 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (TM0066) from Thermotoga maritima at 2.30 A resolution
PDB Compounds: (C:) 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase

SCOPe Domain Sequences for d1vlwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlwc_ c.1.10.1 (C:) KDPG aldolase {Thermotoga maritima [TaxId: 2336]}
hmkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflk
ekgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvk
amklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgs
alvkgtpdevrekakafvekirgc

SCOPe Domain Coordinates for d1vlwc_:

Click to download the PDB-style file with coordinates for d1vlwc_.
(The format of our PDB-style files is described here.)

Timeline for d1vlwc_: