Lineage for d2v7pb1 (2v7p B:22-164)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1832345Species Thermus thermophilus HB8 [TaxId:300852] [187989] (16 PDB entries)
  8. 1832362Domain d2v7pb1: 2v7p B:22-164 [206263]
    Other proteins in same PDB: d2v7pa2, d2v7pb2, d2v7pc2, d2v7pd2
    automated match to d1llda1
    complexed with nad, oxm

Details for d2v7pb1

PDB Entry: 2v7p (more details), 2.1 Å

PDB Description: crystal structure of lactate dehydrogenase from thermus thermophilus hb8 (holo form)
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2v7pb1:

Sequence, based on SEQRES records: (download)

>d2v7pb1 c.2.1.0 (B:22-164) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayrlsglppgrvvgsg

Sequence, based on observed residues (ATOM records): (download)

>d2v7pb1 c.2.1.0 (B:22-164) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaaqlldrnaqvfaqvvprvleaapeavllvatnpvdvmtqvayrlsg
lppgrvvgsg

SCOPe Domain Coordinates for d2v7pb1:

Click to download the PDB-style file with coordinates for d2v7pb1.
(The format of our PDB-style files is described here.)

Timeline for d2v7pb1: