SCOPe 2.05: Domain d2v7pb2: 2v7p B:165-331

Lineage for d2v7pb2 (2v7p B:165-331)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (26 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225328] (7 PDB entries)

8. Domain d2v7pb2: 2v7p B:165-331 [206264]
   Other proteins in same PDB: d2v7pa1, d2v7pb1, d2v7pc1, d2v7pd1
   automated match to d1llda2
   complexed with nad, oxm

Details for d2v7pb2

PDB Entry: 2v7p, 2.1 Å

PDB Description: crystal structure of lactate dehydrogenase from thermus thermophilus hb8 (holo form)

PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2v7pb2:

Sequence; same for both SEQRES and ATOM records:

>d2v7pb2 d.162.1.0 (B:165-331) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
tildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargral
spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpeveg
vlevslslprilgaggvegtvypslspeerealrrsaeilkeaafalgf

Timeline for d2v7pb2:

• d2v7pb2 first appeared in SCOPe 2.03
  
• d2v7pb2 appears in SCOPe 2.04
  
• d2v7pb2 appears in SCOPe 2.06
  
• d2v7pb2 appears in the current release, SCOPe 2.08