Lineage for d2v7pb2 (2v7p B:165-331)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1939262Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1939263Protein automated matches [226850] (26 species)
    not a true protein
  7. 1939396Species Thermus thermophilus HB8 [TaxId:300852] [225328] (7 PDB entries)
  8. 1939402Domain d2v7pb2: 2v7p B:165-331 [206264]
    Other proteins in same PDB: d2v7pa1, d2v7pb1, d2v7pc1, d2v7pd1
    automated match to d1llda2
    complexed with nad, oxm

Details for d2v7pb2

PDB Entry: 2v7p (more details), 2.1 Å

PDB Description: crystal structure of lactate dehydrogenase from thermus thermophilus hb8 (holo form)
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2v7pb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v7pb2 d.162.1.0 (B:165-331) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
tildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargral
spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpeveg
vlevslslprilgaggvegtvypslspeerealrrsaeilkeaafalgf

SCOPe Domain Coordinates for d2v7pb2:

Click to download the PDB-style file with coordinates for d2v7pb2.
(The format of our PDB-style files is described here.)

Timeline for d2v7pb2: