Lineage for d1llda1 (1lld A:7-149)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) Protein Lactate dehydrogenase [51859] (17 species) 
Species Bifidobacterium longum, strain am101-2 [TaxId:216816] [51866] (2 PDB entries) 
Domain d1llda1: 1lld A:7-149 [30177]
Other proteins in same PDB: d1llda2, d1lldb2
complexed with nad
Details for d1llda1
PDB Entry: 1lld (more details), 2 Å
PDB Description: molecular basis of allosteric activation of bacterial l-lactate dehydrogenase
PDB Compounds: (A:) l-lactate dehydrogenaseSCOPe Domain Sequences for d1llda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]}
ptklavigagavgstlafaaaqrgiareivlediakerveaevldmqhgssfyptvsidg
sddpeicrdadmvvitagprqkpgqsrlelvgatvnilkaimpnlvkvapnaiymlitnp
vdiathvaqkltglpenqifgsg
SCOPe Domain Coordinates for d1llda1:
Click to download the PDB-style file with coordinates for d1llda1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1llda1:
- d1llda1 first appeared (with stable ids) in SCOP 1.55
- d1llda1 appears in SCOPe 2.04
- d1llda1 appears in SCOPe 2.06
- d1llda1 appears in the current release, SCOPe 2.08
View in 3D
