SCOPe 2.05: Domain d2v65b1: 2v65 B:2-162

Lineage for d2v65b1 (2v65 B:2-162)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Champsocephalus gunnari [TaxId:52237] [225331] (1 PDB entry)

8. Domain d2v65b1: 2v65 B:2-162 [206237]
   Other proteins in same PDB: d2v65a2, d2v65b2
   automated match to d9ldta1

Details for d2v65b1

PDB Entry: 2v65, 2.35 Å

PDB Description: apo ldh from the psychrophile c. gunnari

PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d2v65b1:

Sequence, based on SEQRES records:

>d2v65b1 c.2.1.0 (B:2-162) automated matches {Champsocephalus gunnari [TaxId: 52237]}
stkeklishvmkeepvgsrskvtvvgvgmvgmasaisillkdlcdelamvdvmedklkge
vmdlqhgslflktkivgdkdysvtanskvvvvtagarqqegesrlnlvqrnvnifkfiip
nivkyspncilmvvsnpvdiltyvawklsgfprhrvig

Sequence, based on observed residues (ATOM records):

>d2v65b1 c.2.1.0 (B:2-162) automated matches {Champsocephalus gunnari [TaxId: 52237]}
stkeklishvmkeepvgsrskvtvvgvgmvgmasaisillkdlcdelamvdvmedklkge
vmdlqhgslflktkivgdkdysvtanskvvvvtagaesrlnlvqrnvnifkfiipnivky
spncilmvvsnpvdiltyvawklsgfprhrvig

Timeline for d2v65b1:

• d2v65b1 first appeared in SCOPe 2.03
  
• d2v65b1 appears in SCOPe 2.04
  
• d2v65b1 appears in SCOPe 2.06
  
• d2v65b1 appears in the current release, SCOPe 2.08