| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
| Protein automated matches [226850] (26 species) not a true protein |
| Species Champsocephalus gunnari [TaxId:52237] [225332] (1 PDB entry) |
| Domain d2v65a2: 2v65 A:163-331 [206236] Other proteins in same PDB: d2v65a1, d2v65b1 automated match to d9ldta2 |
PDB Entry: 2v65 (more details), 2.35 Å
SCOPe Domain Sequences for d2v65a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v65a2 d.162.1.0 (A:163-331) automated matches {Champsocephalus gunnari [TaxId: 52237]}
sgtnldsarfrhligeklhlhpsschawivgehgdssvpvwsgvnvagvslqglnpqmgt
egdgenwkaihkevvdgayeviklkgytswaigmsvadlvesiiknmhkvhpvstlvqgm
hgvkdevflsvpcvlgnsgltdvihmtlkaeeekqlqksaetlwgvqkeltl
Timeline for d2v65a2: