PDB entry 2v65

View 2v65 on RCSB PDB site
Description: Apo LDH from the psychrophile C. gunnari
Class: oxidoreductase
Keywords: oxidoreductase, lactate dehydrogenase, nad, fish, glycolysis
Deposited on 2007-07-13, released 2007-09-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.228
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase A chain
    Species: CHAMPSOCEPHALUS GUNNARI [TaxId:52237]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V65
    • Uniprot O93541 (1-330)
    Domains in SCOPe 2.05: d2v65a1, d2v65a2
  • Chain 'B':
    Compound: L-lactate dehydrogenase A chain
    Species: CHAMPSOCEPHALUS GUNNARI [TaxId:52237]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V65
    • Uniprot O93541 (1-330)
    Domains in SCOPe 2.05: d2v65b1, d2v65b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v65A (A:)
    mstkeklishvmkeepvgsrskvtvvgvgmvgmasaisillkdlcdelamvdvmedklkg
    evmdlqhgslflktkivgdkdysvtanskvvvvtagarqqegesrlnlvqrnvnifkfii
    pnivkyspncilmvvsnpvdiltyvawklsgfprhrvigsgtnldsarfrhligeklhlh
    psschawivgehgdssvpvwsgvnvagvslqglnpqmgtegdgenwkaihkevvdgayev
    iklkgytswaigmsvadlvesiiknmhkvhpvstlvqgmhgvkdevflsvpcvlgnsglt
    dvihmtlkaeeekqlqksaetlwgvqkeltl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v65A (A:)
    stkeklishvmkeepvgsrskvtvvgvgmvgmasaisillkdlcdelamvdvmedklkge
    vmdlqhgslflktkivgdkdysvtanskvvvvtagagesrlnlvqrnvnifkfiipnivk
    yspncilmvvsnpvdiltyvawklsgfprhrvigsgtnldsarfrhligeklhlhpssch
    awivgehgdssvpvwsgvnvagvslqglnpqmgtegdgenwkaihkevvdgayeviklkg
    ytswaigmsvadlvesiiknmhkvhpvstlvqgmhgvkdevflsvpcvlgnsgltdvihm
    tlkaeeekqlqksaetlwgvqkeltl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v65B (B:)
    mstkeklishvmkeepvgsrskvtvvgvgmvgmasaisillkdlcdelamvdvmedklkg
    evmdlqhgslflktkivgdkdysvtanskvvvvtagarqqegesrlnlvqrnvnifkfii
    pnivkyspncilmvvsnpvdiltyvawklsgfprhrvigsgtnldsarfrhligeklhlh
    psschawivgehgdssvpvwsgvnvagvslqglnpqmgtegdgenwkaihkevvdgayev
    iklkgytswaigmsvadlvesiiknmhkvhpvstlvqgmhgvkdevflsvpcvlgnsglt
    dvihmtlkaeeekqlqksaetlwgvqkeltl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v65B (B:)
    stkeklishvmkeepvgsrskvtvvgvgmvgmasaisillkdlcdelamvdvmedklkge
    vmdlqhgslflktkivgdkdysvtanskvvvvtagaesrlnlvqrnvnifkfiipnivky
    spncilmvvsnpvdiltyvawklsgfprhrvigsgtnldsarfrhligeklhlhpsscha
    wivgehgdssvpvwsgvnvagvslqglnpqmgtegdgenwkaihkevvdgayeviklkgy
    tswaigmsvadlvesiiknmhkvhpvstlvqgmhgvkdevflsvpcvlgnsgltdvihmt
    lkaeeekqlqksaetlwgvqkeltl