SCOPe 2.08: Domain d2rgwc2: 2rgw C:149-303

Lineage for d2rgwc2 (2rgw C:149-303)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)

7. Species Methanococcus jannaschii [TaxId:2190] [225539] (1 PDB entry)

8. Domain d2rgwc2: 2rgw C:149-303 [206112]
   automated match to d1pg5a2
   complexed with so4

Details for d2rgwc2

PDB Entry: 2rgw, 2.8 Å

PDB Description: Catalytic Subunit of M. jannaschii Aspartate Transcarbamoylase

PDB Compounds: (C:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d2rgwc2:

Sequence; same for both SEQRES and ATOM records:

>d2rgwc2 c.78.1.1 (C:149-303) Aspartate carbamoyltransferase catalytic subunit {Methanococcus jannaschii [TaxId: 2190]}
idgikiafvgdlkygrtvhslvyalslfenvemyfvspkelrlpkdiiedlkaknikfye
keslddldddidvlyvtriqkerfpdpneyekvkgsykikreyvegkkfiimhplprvde
idydvddlpqakyfkqsfygipvrmailkkliedn

Timeline for d2rgwc2:

• d2rgwc2 first appeared in SCOPe 2.03
  
• d2rgwc2 appears in SCOPe 2.07