Lineage for d2rgwe2 (2rgw E:149-303)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906434Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2906435Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2906717Species Methanococcus jannaschii [TaxId:2190] [225539] (1 PDB entry)
  8. 2906727Domain d2rgwe2: 2rgw E:149-303 [206116]
    automated match to d1pg5a2
    complexed with so4

Details for d2rgwe2

PDB Entry: 2rgw (more details), 2.8 Å

PDB Description: Catalytic Subunit of M. jannaschii Aspartate Transcarbamoylase
PDB Compounds: (E:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d2rgwe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rgwe2 c.78.1.1 (E:149-303) Aspartate carbamoyltransferase catalytic subunit {Methanococcus jannaschii [TaxId: 2190]}
idgikiafvgdlkygrtvhslvyalslfenvemyfvspkelrlpkdiiedlkaknikfye
keslddldddidvlyvtriqkerfpdpneyekvkgsykikreyvegkkfiimhplprvde
idydvddlpqakyfkqsfygipvrmailkkliedn

SCOPe Domain Coordinates for d2rgwe2:

Click to download the PDB-style file with coordinates for d2rgwe2.
(The format of our PDB-style files is described here.)

Timeline for d2rgwe2: