Lineage for d2rgwf1 (2rgw F:1-148)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139045Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2139046Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2139047Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 protein domains)
  6. 2139048Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2139331Species Methanococcus jannaschii [TaxId:2190] [225539] (1 PDB entry)
  8. 2139342Domain d2rgwf1: 2rgw F:1-148 [206117]
    automated match to d1pg5a1
    complexed with so4

Details for d2rgwf1

PDB Entry: 2rgw (more details), 2.8 Å

PDB Description: Catalytic Subunit of M. jannaschii Aspartate Transcarbamoylase
PDB Compounds: (F:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d2rgwf1:

Sequence, based on SEQRES records: (download)

>d2rgwf1 c.78.1.1 (F:1-148) Aspartate carbamoyltransferase catalytic subunit {Methanococcus jannaschii [TaxId: 2190]}
mkhlismkdigkeeileildearkmeellntkrplkllegkilatvfyepstrtrlsfet
amkrlggevitmtdlksssvakgeslidtirvisgyadiivlrhpsegaarlaseysqvp
iinagdgsnqhptqtlldlytimreigr

Sequence, based on observed residues (ATOM records): (download)

>d2rgwf1 c.78.1.1 (F:1-148) Aspartate carbamoyltransferase catalytic subunit {Methanococcus jannaschii [TaxId: 2190]}
mkhlismkdigkeeileildearkmeellntkrplkllegkilatvfyepstrtrlsfet
amkrlggevitmtdlksssvakgeslidtirvisgyadiivlrhpsegaarlaseysqvp
iinagqhptqtlldlytimreigr

SCOPe Domain Coordinates for d2rgwf1:

Click to download the PDB-style file with coordinates for d2rgwf1.
(The format of our PDB-style files is described here.)

Timeline for d2rgwf1: