![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
![]() | Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [225539] (1 PDB entry) |
![]() | Domain d2rgwb2: 2rgw B:149-303 [206110] automated match to d1pg5a2 complexed with so4 |
PDB Entry: 2rgw (more details), 2.8 Å
SCOPe Domain Sequences for d2rgwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rgwb2 c.78.1.1 (B:149-303) Aspartate carbamoyltransferase catalytic subunit {Methanococcus jannaschii [TaxId: 2190]} idgikiafvgdlkygrtvhslvyalslfenvemyfvspkelrlpkdiiedlkaknikfye keslddldddidvlyvtriqkerfpdpneyekvkgsykikreyvegkkfiimhplprvde idydvddlpqakyfkqsfygipvrmailkkliedn
Timeline for d2rgwb2: