SCOPe 2.04: Domain d2r4hb_: 2r4h B:

Lineage for d2r4hb_ (2r4h B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (75 PDB entries)

8. Domain d2r4hb_: 2r4h B: [205966]
   automated match to d2q3gb_
   complexed with his; mutant

Details for d2r4hb_

PDB Entry: 2r4h, 2.05 Å

PDB Description: crystal structure of a c1190s mutant of the 6th pdz domain of human membrane associated guanylate kinase

PDB Compounds: (B:) Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1

SCOPe Domain Sequences for d2r4hb_:

Sequence; same for both SEQRES and ATOM records:

>d2r4hb_ b.36.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfytvelergakgfgfslrggreynmdlyvlrlaedgpaersgkmrigdeileingettk
nmkhsraieliknggrrvrlflkrgetsv

Timeline for d2r4hb_:

• d2r4hb_ first appeared in SCOPe 2.03
  
• d2r4hb_ appears in SCOPe 2.05
  
• d2r4hb_ appears in the current release, SCOPe 2.08, called d2r4hb1