SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2r4hb1 (2r4h B:2-86)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048811Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2048812Protein automated matches [190436] (8 species)
    not a true protein
  7. 2048826Species Human (Homo sapiens) [TaxId:9606] [187333] (87 PDB entries)
  8. 2048915Domain d2r4hb1: 2r4h B:2-86 [205966]
    Other proteins in same PDB: d2r4ha2, d2r4ha3, d2r4hb2, d2r4hc2, d2r4hc3
    automated match to d2q3gb_
    complexed with his; mutant

Details for d2r4hb1

PDB Entry: 2r4h (more details), 2.05 Å

PDB Description: Crystal structure of a C1190S mutant of the 6th PDZ domain of human membrane associated guanylate kinase
PDB Compounds: (B:) Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1

SCOPe Domain Sequences for d2r4hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r4hb1 b.36.1.0 (B:2-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfytvelergakgfgfslrggreynmdlyvlrlaedgpaersgkmrigdeileingettk
nmkhsraieliknggrrvrlflkrg

SCOPe Domain Coordinates for d2r4hb1:

Click to download the PDB-style file with coordinates for d2r4hb1.
(The format of our PDB-style files is described here.)

Timeline for d2r4hb1: