PDB entry 2r4h

View 2r4h on RCSB PDB site
Description: Crystal structure of a C1190S mutant of the 6th PDZ domain of human membrane associated guanylate kinase
Class: transferase
Keywords: TRANSFERASE, PDZ, MEMBRANE ASSOCIATED GUANYLATE KINASE, Structural Genomics, Structural Genomics Consortium, SGC, ATP-binding, Cell junction, Nucleotide-binding, Phosphorylation, Tight junction
Deposited on 2007-08-31, released 2007-10-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.191
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAGI1, BAIAP1, BAP1, TNRC19
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96QZ7 (23-107)
      • expression tag (22)
      • engineered (64)
      • expression tag (108-111)
    Domains in SCOPe 2.04: d2r4ha_
  • Chain 'B':
    Compound: Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAGI1, BAIAP1, BAP1, TNRC19
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96QZ7 (23-107)
      • engineered (64)
      • expression tag (108-111)
    Domains in SCOPe 2.04: d2r4hb_
  • Chain 'C':
    Compound: Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAGI1, BAIAP1, BAP1, TNRC19
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96QZ7 (23-107)
      • expression tag (14-22)
      • engineered (64)
      • expression tag (108-111)
    Domains in SCOPe 2.04: d2r4hc_
  • Heterogens: HIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2r4hA (A:)
    mhhhhhhssgvdlgtenlyfqsmdfytvelergakgfgfslrggreynmdlyvlrlaedg
    paersgkmrigdeileingettknmkhsraieliknggrrvrlflkrgetsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r4hA (A:)
    mdfytvelergakgfgfslrggreynmdlyvlrlaedgpaersgkmrigdeileingett
    knmkhsraieliknggrrvrlflkrgetsv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2r4hB (B:)
    mhhhhhhssgvdlgtenlyfqsmdfytvelergakgfgfslrggreynmdlyvlrlaedg
    paersgkmrigdeileingettknmkhsraieliknggrrvrlflkrgetsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r4hB (B:)
    dfytvelergakgfgfslrggreynmdlyvlrlaedgpaersgkmrigdeileingettk
    nmkhsraieliknggrrvrlflkrgetsv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2r4hC (C:)
    mhhhhhhssgvdlgtenlyfqsmdfytvelergakgfgfslrggreynmdlyvlrlaedg
    paersgkmrigdeileingettknmkhsraieliknggrrvrlflkrgetsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2r4hC (C:)
    tenlyfqsmdfytvelergakgfgfslrggreynmdlyvlrlaedgpaersgkmrigdei
    leingettknmkhsraieliknggrrvrlflkrgetsv