Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein automated matches [190135] (18 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [225389] (2 PDB entries) |
Domain d2qz3b_: 2qz3 B: [205906] automated match to d2b42b_ complexed with acy |
PDB Entry: 2qz3 (more details), 1.8 Å
SCOPe Domain Sequences for d2qz3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qz3b_ b.29.1.11 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} stdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwapn gngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidgd rttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmatagyqssgssn vtvw
Timeline for d2qz3b_: