SCOPe 2.03: Domain d2qz3b_: 2qz3 B:

Lineage for d2qz3b_ (2qz3 B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein automated matches [190135] (7 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [225389] (2 PDB entries)

8. Domain d2qz3b_: 2qz3 B: [205906]
   automated match to d2b42b_
   complexed with acy

Details for d2qz3b_

PDB Entry: 2qz3, 1.8 Å

PDB Description: crystal structure of a glycoside hydrolase family 11 xylanase from bacillus subtilis in complex with xylotetraose

PDB Compounds: (B:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d2qz3b_:

Sequence; same for both SEQRES and ATOM records:

>d2qz3b_ b.29.1.11 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
stdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwapn
gngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidgd
rttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmatagyqssgssn
vtvw

Timeline for d2qz3b_:

• d2qz3b_ is new in SCOPe 2.03-stable
  
• d2qz3b_ appears in SCOPe 2.04
  
• d2qz3b_ appears in the current release, SCOPe 2.08