Lineage for d2qz3b_ (2qz3 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780261Protein automated matches [190135] (18 species)
    not a true protein
  7. 2780274Species Bacillus subtilis [TaxId:1423] [225389] (2 PDB entries)
  8. 2780278Domain d2qz3b_: 2qz3 B: [205906]
    automated match to d2b42b_
    complexed with acy

Details for d2qz3b_

PDB Entry: 2qz3 (more details), 1.8 Å

PDB Description: crystal structure of a glycoside hydrolase family 11 xylanase from bacillus subtilis in complex with xylotetraose
PDB Compounds: (B:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d2qz3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qz3b_ b.29.1.11 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
stdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwapn
gngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidgd
rttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmatagyqssgssn
vtvw

SCOPe Domain Coordinates for d2qz3b_:

Click to download the PDB-style file with coordinates for d2qz3b_.
(The format of our PDB-style files is described here.)

Timeline for d2qz3b_: