Lineage for d2qyma_ (2qym A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2014926Family a.211.1.2: PDEase [48548] (7 protein domains)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2015191Protein automated matches [190370] (1 species)
    not a true protein
  7. 2015192Species Human (Homo sapiens) [TaxId:9606] [187208] (27 PDB entries)
  8. 2015198Domain d2qyma_: 2qym A: [205900]
    automated match to d1f0ja_
    complexed with mg, zn

Details for d2qyma_

PDB Entry: 2qym (more details), 1.9 Å

PDB Description: crystal structure of unliganded PDE4C2
PDB Compounds: (A:) Phosphodiesterase 4C

SCOPe Domain Sequences for d2qyma_:

Sequence, based on SEQRES records: (download)

>d2qyma_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vprfgvqtdqeeqlakeledtnkwgldvfkvaelsgnrpltaiifsifqerdllktfqip
adtlatyllmleghyhanvayhnslhaadvaqsthvllatpaleavftdleilaalfasa
ihdvdhpgvsnqflintnselalmyndasvlenhhlavgfkllqaencdifqnlsakqrl
slrrmvidmvlatdmskhmnlladlktmvetkkvtslgvllldnysdriqvlqnlvhcad
lsnptkplplyrqwtdrimaeffqqgdreresgldispmcdkhtasveksqvgfidyiah
plwetwadlvhpdaqdlldtlednrewyq

Sequence, based on observed residues (ATOM records): (download)

>d2qyma_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vprfgvqtdqeeqlakeledtnkwgldvfkvaelsgnrpltaiifsifqerdllktfqip
adtlatyllmleghyhanvayhnslhaadvaqsthvllatpaleavftdleilaalfasa
ihdvdhpgvsnqndasvlenhhlavgfkllqaencdifqnlsakqrlslrrmvidmvlat
dmskhmnlladlktmvetkkvtslgvllldnysdriqvlqnlvhcadlsnptkplplyrq
wtdrimaeffqqqvgfidyiahplwetwadlvhpdaqdlldtlednrewyq

SCOPe Domain Coordinates for d2qyma_:

Click to download the PDB-style file with coordinates for d2qyma_.
(The format of our PDB-style files is described here.)

Timeline for d2qyma_: