PDB entry 2qym

View 2qym on RCSB PDB site
Description: crystal structure of unliganded PDE4C2
Class: hydrolase
Keywords: PDE4C structure, Hydrolase
Deposited on 2007-08-15, released 2008-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphodiesterase 4C
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4C2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KYS4
      • conflict (38)
    Domains in SCOPe 2.07: d2qyma_
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qymA (A:)
    tvprfgvqtdqeeqlakeledtnkwgldvfkvaelsgnrpltaiifsifqerdllktfqi
    padtlatyllmleghyhanvayhnslhaadvaqsthvllatpaleavftdleilaalfas
    aihdvdhpgvsnqflintnselalmyndasvlenhhlavgfkllqaencdifqnlsakqr
    lslrrmvidmvlatdmskhmnlladlktmvetkkvtslgvllldnysdriqvlqnlvhca
    dlsnptkplplyrqwtdrimaeffqqgdreresgldispmcdkhtasveksqvgfidyia
    hplwetwadlvhpdaqdlldtlednrewyqskiprspsdltnperdgpdrfqfeltle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qymA (A:)
    vprfgvqtdqeeqlakeledtnkwgldvfkvaelsgnrpltaiifsifqerdllktfqip
    adtlatyllmleghyhanvayhnslhaadvaqsthvllatpaleavftdleilaalfasa
    ihdvdhpgvsnqndasvlenhhlavgfkllqaencdifqnlsakqrlslrrmvidmvlat
    dmskhmnlladlktmvetkkvtslgvllldnysdriqvlqnlvhcadlsnptkplplyrq
    wtdrimaeffqqqvgfidyiahplwetwadlvhpdaqdlldtlednrewyq