| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (55 species) not a true protein |
| Species Zymomonas mobilis [TaxId:542] [225232] (1 PDB entry) |
| Domain d2ox4g1: 2ox4 G:0-118 [205390] Other proteins in same PDB: d2ox4a2, d2ox4b2, d2ox4c2, d2ox4d2, d2ox4e2, d2ox4f2, d2ox4g2, d2ox4h2 automated match to d2gl5a2 complexed with cl, gol, mg |
PDB Entry: 2ox4 (more details), 1.8 Å
SCOPe Domain Sequences for d2ox4g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ox4g1 d.54.1.0 (G:0-118) automated matches {Zymomonas mobilis [TaxId: 542]}
slkitkieifhvhtrpqsgqrpilvkvstdegiyglgeagiaygvggsaaagilkdyaal
ligedpfnteaiweklfkktfwgqgggtvifsgisafdiafwdikgkalnlpvykllgg
Timeline for d2ox4g1: