Lineage for d2ox4g1 (2ox4 G:0-118)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413344Species Zymomonas mobilis [TaxId:542] [225232] (1 PDB entry)
  8. 1413351Domain d2ox4g1: 2ox4 G:0-118 [205390]
    Other proteins in same PDB: d2ox4a2, d2ox4b2, d2ox4c2, d2ox4d2, d2ox4e2, d2ox4f2, d2ox4g2, d2ox4h2
    automated match to d2gl5a2
    complexed with cl, gol, mg

Details for d2ox4g1

PDB Entry: 2ox4 (more details), 1.8 Å

PDB Description: crystal structure of putative dehydratase from zymomonas mobilis zm4
PDB Compounds: (G:) Putative mandelate racemase

SCOPe Domain Sequences for d2ox4g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ox4g1 d.54.1.0 (G:0-118) automated matches {Zymomonas mobilis [TaxId: 542]}
slkitkieifhvhtrpqsgqrpilvkvstdegiyglgeagiaygvggsaaagilkdyaal
ligedpfnteaiweklfkktfwgqgggtvifsgisafdiafwdikgkalnlpvykllgg

SCOPe Domain Coordinates for d2ox4g1:

Click to download the PDB-style file with coordinates for d2ox4g1.
(The format of our PDB-style files is described here.)

Timeline for d2ox4g1: