| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (45 species) not a true protein |
| Species Zymomonas mobilis [TaxId:542] [225233] (1 PDB entry) |
| Domain d2ox4h2: 2ox4 H:119-392 [205393] Other proteins in same PDB: d2ox4a1, d2ox4b1, d2ox4c1, d2ox4d1, d2ox4e1, d2ox4f1, d2ox4g1, d2ox4h1 automated match to d2gl5a1 complexed with cl, gol, mg |
PDB Entry: 2ox4 (more details), 1.8 Å
SCOPe Domain Sequences for d2ox4h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ox4h2 c.1.11.0 (H:119-392) automated matches {Zymomonas mobilis [TaxId: 542]}
knredlrvyasqlqfgwgkerkskgrkeeyaeealkavaegydavkvdvlahdrngsreg
vflegplpsetikigverveairnavgpdvdiivenhghtdlvsaiqfakaieefniffy
eeintplnprllkeakkkidiplasgeriysrwgflpfledrsidviqpdlgtcggftef
kkiadmahifevtvqahvagtgvaeaaslhaeiaipnfcihehhqktllpeyeelcvhny
qpvkgrykvpelpgigqditeklyqisdyvsiea
Timeline for d2ox4h2: