| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins) C-terminal domain is beta/alpha-barrel |
| Protein Putative dehydratase protein STM2273 [143250] (2 species) |
| Species Salmonella typhimurium [TaxId:90371] [143251] (1 PDB entry) Uniprot Q8ZNH1 1-122 |
| Domain d2gl5a2: 2gl5 A:1-122 [135337] Other proteins in same PDB: d2gl5a1, d2gl5b1 complexed with gol, mg |
PDB Entry: 2gl5 (more details), 1.6 Å
SCOPe Domain Sequences for d2gl5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gl5a2 d.54.1.1 (A:1-122) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]}
lkitsievfdcelkkrdqtmssynpvlirvntdsglsgigevglaygagakagvgiirdl
aplivgedplniekiwefffrktfwgmgggnvfyagmsaidialwdikgkylgvpvyqll
gg
Timeline for d2gl5a2: