Lineage for d2ocza1 (2ocz A:1-223)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834951Protein Type I 3-dehydroquinate dehydratase [51586] (4 species)
  7. 2834986Species Streptococcus pyogenes [TaxId:301447] [225216] (1 PDB entry)
  8. 2834987Domain d2ocza1: 2ocz A:1-223 [205249]
    Other proteins in same PDB: d2ocza2
    automated match to d1sfja_
    complexed with edo, mg

Details for d2ocza1

PDB Entry: 2ocz (more details), 1.85 Å

PDB Description: The Structure of a Putative 3-Dehydroquinate Dehydratase from Streptococcus pyogenes.
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d2ocza1:

Sequence, based on SEQRES records: (download)

>d2ocza1 c.1.10.1 (A:1-223) Type I 3-dehydroquinate dehydratase {Streptococcus pyogenes [TaxId: 301447]}
mrivapvmprhfdeaqaidiskyedvnliewradflpkdeivavapaifekfagkeiift
lrtvqeggnitlssqeyvdiikeinaiynpdyidfeyfthksvfqemldfpnlilsyhnf
eetpenlmeafsemtklaprvvkiavmpqseqdvldlmnytrgfktlnpeqefatismgk
lgrlsrfagdvigsswtyvsldhvsgpgqvtlndmkriievle

Sequence, based on observed residues (ATOM records): (download)

>d2ocza1 c.1.10.1 (A:1-223) Type I 3-dehydroquinate dehydratase {Streptococcus pyogenes [TaxId: 301447]}
mrivapvmprhfdeaqaidiskyedvnliewradflpkdeivavapaifekfagkeiift
lrtvqeggnitlssqeyvdiikeinaiynpdyidfeyfthksvfqemldfpnlilsyhnf
eetpenlmeafsemtklaprvvkiavmpqseqdvldlmnytrgfktlnpeqefatismgk
lgrlsrfagdvigsswtyvslgqvtlndmkriievle

SCOPe Domain Coordinates for d2ocza1:

Click to download the PDB-style file with coordinates for d2ocza1.
(The format of our PDB-style files is described here.)

Timeline for d2ocza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ocza2