PDB entry 2ocz

View 2ocz on RCSB PDB site
Description: The Structure of a Putative 3-Dehydroquinate Dehydratase from Streptococcus pyogenes.
Class: lyase
Keywords: structural genomics, Type I 3-dehydroquinate dehydratase, DHQase, Streptococcus pyogenes, dehydroshikimate, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, LYASE
Deposited on 2006-12-21, released 2007-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.178
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptococcus pyogenes serotype M1 [TaxId:301447]
    Gene: aroD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63590 (3-End)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (10)
      • modified residue (109)
      • modified residue (130)
      • modified residue (136)
      • modified residue (149)
      • modified residue (160)
      • modified residue (180)
      • modified residue (217)
    Domains in SCOPe 2.07: d2ocza1, d2ocza2
  • Heterogens: MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oczA (A:)
    snamrivapvmprhfdeaqaidiskyedvnliewradflpkdeivavapaifekfagkei
    iftlrtvqeggnitlssqeyvdiikeinaiynpdyidfeyfthksvfqemldfpnlilsy
    hnfeetpenlmeafsemtklaprvvkiavmpqseqdvldlmnytrgfktlnpeqefatis
    mgklgrlsrfagdvigsswtyvsldhvsgpgqvtlndmkriievlemdisn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oczA (A:)
    amrivapvmprhfdeaqaidiskyedvnliewradflpkdeivavapaifekfagkeiif
    tlrtvqeggnitlssqeyvdiikeinaiynpdyidfeyfthksvfqemldfpnlilsyhn
    feetpenlmeafsemtklaprvvkiavmpqseqdvldlmnytrgfktlnpeqefatismg
    klgrlsrfagdvigsswtyvslgqvtlndmkriievle