SCOPe 2.08: Domain d2ntii1: 2nti I:1-126

Lineage for d2ntii1 (2nti I:1-126)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [225354] (3 PDB entries)

8. Domain d2ntii1: 2nti I:1-126 [205172]
   automated match to d1ud9a1
   complexed with 7pg, br, k

Details for d2ntii1

PDB Entry: 2nti, 2.5 Å

PDB Description: crystal structure of pcna123 heterotrimer.

PDB Compounds: (I:) DNA polymerase sliding clamp A

SCOPe Domain Sequences for d2ntii1:

Sequence, based on SEQRES records:

>d2ntii1 d.131.1.0 (I:1-126) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mkvvyddvrvlkdiiqalarlvdeavlkfkqdsvelvaldrahislisvnlpremfkeyd
vndefkfgfntqylmkilkvakrkeaieiasespdsviiniigstnrefnvrnlevseqe
ipeinl

Sequence, based on observed residues (ATOM records):

>d2ntii1 d.131.1.0 (I:1-126) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mkvvyddvrvlkdiiqalarlvdeavlkfkqdsvelvaldrahislisvnlpremfkeyd
vndefkfgfntqylmkilkvakrkeaieiasespdsviiniigstnrefnvrnlevseqe
ipnl

Timeline for d2ntii1:

• d2ntii1 first appeared in SCOPe 2.03
  
• d2ntii1 appears in SCOPe 2.07