![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
![]() | Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
![]() | Protein automated matches [226907] (28 species) not a true protein |
![]() | Species Sulfolobus solfataricus [TaxId:273057] [225354] (3 PDB entries) |
![]() | Domain d2ntie1: 2nti E:1-127 [205166] automated match to d1ud9a1 complexed with 7pg, br, k |
PDB Entry: 2nti (more details), 2.5 Å
SCOPe Domain Sequences for d2ntie1:
Sequence, based on SEQRES records: (download)
>d2ntie1 d.131.1.0 (E:1-127) automated matches {Sulfolobus solfataricus [TaxId: 273057]} mmkakvidavsfsyilrtvgdflseanfivtkegirvsgidpsrvvfldiflpssyfegf evsqekeiigfkledvndilkrvlkddtlilssneskltltfdgeftrsfelpliqvest qppsvnl
>d2ntie1 d.131.1.0 (E:1-127) automated matches {Sulfolobus solfataricus [TaxId: 273057]} mmkakvidavsfsyilrtvgdflseanfivtkegirvsgidpsrvvfldiflpssyfegf evsqekeiigfkledvndilkrvlkddtlilssneskltltfdgeftrsfelpliqvest qppnl
Timeline for d2ntie1: