| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.21: ets domain [46859] (9 proteins) |
| Protein automated matches [191121] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [193283] (15 PDB entries) |
| Domain d2nnyb_: 2nny B: [205119] automated match to d1gvja_ protein/DNA complex |
PDB Entry: 2nny (more details), 2.58 Å
SCOPe Domain Sequences for d2nnyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nnyb_ a.4.5.21 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrdradlnkdkpvipaaalagytgsgpiqlwqfllelltdkssqsfiswtgdgwefklsd
pdevarrwgkrknkpkmnyeklsrglryyydkniihktagkryvyrfvsdlqsllgytpe
elhamldvk
Timeline for d2nnyb_: