![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
![]() | Superfamily c.80.1: SIS domain [53697] (4 families) ![]() |
![]() | Family c.80.1.0: automated matches [191405] (1 protein) not a true family |
![]() | Protein automated matches [190547] (16 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [226782] (2 PDB entries) |
![]() | Domain d2i2wc_: 2i2w C: [204693] automated match to d2xblb_ complexed with gol |
PDB Entry: 2i2w (more details), 1.95 Å
SCOPe Domain Sequences for d2i2wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2wc_ c.80.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]} myqdlirnelneaaetlanflkddanihaiqraavlladsfkaggkvlscgnggshcdam hfaeeltgryrenrpgypaiaisdvshiscvgndfgfndifsryveavgregdvllgist sgnsanvikaiaaarekgmkvitltgkdggkmagtadieirvphfgyadriqeihikvih iliqliekemvk
Timeline for d2i2wc_: