SCOPe 2.07: Domain d2i2wc_: 2i2w C:

Lineage for d2i2wc_ (2i2w C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.0: automated matches [191405] (1 protein)
   not a true family

6. Protein automated matches [190547] (16 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [226782] (2 PDB entries)

8. Domain d2i2wc_: 2i2w C: [204693]
   automated match to d2xblb_
   complexed with gol

Details for d2i2wc_

PDB Entry: 2i2w, 1.95 Å

PDB Description: Crystal Structure of Escherichia Coli Phosphoheptose Isomerase

PDB Compounds: (C:) Phosphoheptose isomerase

SCOPe Domain Sequences for d2i2wc_:

Sequence; same for both SEQRES and ATOM records:

>d2i2wc_ c.80.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]}
myqdlirnelneaaetlanflkddanihaiqraavlladsfkaggkvlscgnggshcdam
hfaeeltgryrenrpgypaiaisdvshiscvgndfgfndifsryveavgregdvllgist
sgnsanvikaiaaarekgmkvitltgkdggkmagtadieirvphfgyadriqeihikvih
iliqliekemvk

Timeline for d2i2wc_:

• d2i2wc_ first appeared in SCOPe 2.03
  
• d2i2wc_ appears in SCOPe 2.06
  
• d2i2wc_ appears in the current release, SCOPe 2.08